PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa03g028490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 255aa    MW: 29457.7 Da    PI: 4.8737
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa03g028490.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.4e-1870123356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eql++Le+ Fe  +++  +++ eLA+ lgL+ rq+ +WFqNrRa+ k
  Csa03g028490.1  70 KKRRLNMEQLKTLEKNFEIGNKLESDRKIELARALGLQPRQIAIWFQNRRARSK 123
                     456899**********************************************99 PP

2HD-ZIP_I/II122.42.3e-3969161193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eq+k+LE++Fe  +kLe++rK elar+Lglqprq+a+WFqnrRAR ktkqlEkdy+ Lkr++++l++ene L++++++L++++++
  Csa03g028490.1  69 EKKRRLNMEQLKTLEKNFEIGNKLESDRKIELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDILKRQFESLRDENEVLQTQNQKLQAQVMA 161
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.19E-1953127IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1857125IPR009057Homeodomain-like
PROSITE profilePS5007117.0765125IPR001356Homeobox domain
SMARTSM003893.9E-1868129IPR001356Homeobox domain
CDDcd000866.13E-1570126No hitNo description
PfamPF000464.9E-1570123IPR001356Homeobox domain
PRINTSPR000314.8E-696105IPR000047Helix-turn-helix motif
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PRINTSPR000314.8E-6105121IPR000047Helix-turn-helix motif
SMARTSM003400.0054125168IPR003106Leucine zipper, homeobox-associated
PfamPF021831.0E-14125165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSCNNGLAFF PENFSLQNHQ QQEEDHPQLL QDFNGFLGKR SPINNVQGFC NLDMNGEEEY  60
SDDGSKMGEK KRRLNMEQLK TLEKNFEIGN KLESDRKIEL ARALGLQPRQ IAIWFQNRRA  120
RSKTKQLEKD YDILKRQFES LRDENEVLQT QNQKLQAQVM ALKSREPIES INLNKETEGS  180
CSDRSENISG DIRPPEIDSQ CALGHPPTAT TMQFFQNSSS EQRMVKEENS ISNMFCGIDD  240
QSGFWPWLDQ QHYN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARSKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2280560.0AK228056.1 Arabidopsis thaliana mRNA for putative DNA-binding protein, complete cds, clone: RAFL14-55-J15.
GenBankAY0849130.0AY084913.1 Arabidopsis thaliana clone 121220 mRNA, complete sequence.
GenBankBT0097270.0BT009727.1 Arabidopsis thaliana At1g26960 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010498978.10.0PREDICTED: homeobox-leucine zipper protein ATHB-23
SwissprotQ8LFD30.0ATB23_ARATH; Homeobox-leucine zipper protein ATHB-23
TrEMBLR0I4580.0R0I458_9BRAS; Uncharacterized protein
STRINGAT1G26960.11e-179(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26960.10.0homeobox protein 23